PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G199800.1.p
Common NameSb06g027180, SORBIDRAFT_06g027180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 377aa    MW: 40574.3 Da    PI: 4.5336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G199800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161663148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Sobic.006G199800.1.p 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                          799*****************************99************97 PP

2Myb_DNA-binding54.13.6e-1769114148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T++E+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Sobic.006G199800.1.p  69 RGNFTADEEETIIKLHAMLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466892.21E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002493.0E-151663IPR001005SANT/Myb domain
CDDcd001673.17E-111863No hitNo description
PROSITE profilePS5129424.63464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2667117IPR009057Homeodomain-like
SMARTSM007174.0E-1568116IPR001005SANT/Myb domain
PfamPF002491.9E-1569114IPR001005SANT/Myb domain
CDDcd001671.16E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEETI IKLHAMLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSP  120
AGGGEERGAK KKKKKKEAAA GGGAEEPLPS PSPSPSSSTT TTTTTNCSSG DDSGEQQSNT  180
SKEEPDDDEL DLENLEMMRM LDDPITFGFD MLVDPVPPPA PYGPAVSSPT SPCASSGVDD  240
HLLVLPEIDI DHELWSIIDG DACTVADAEA PAPCCQLSNA SQPPNGGANT SSHGAEEGKE  300
WWLEDLEREL GLWGPVEEYQ YQYPMGPHGL VADQPDPLPA MVDDPVSCYF EAGPASAMLQ  360
EPAYSAAVTS SNHVGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-28141182105C-Myb DNA-Binding Domain
1msf_C2e-28141182105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114135KKRVSPAGGGEERGAKKKKKKK
2129135KKKKKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701450.0BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448440.10.0hypothetical protein SORBIDRAFT_06g027180
SwissprotP200241e-106MYB1_MAIZE; Myb-related protein Zm1
TrEMBLC5YF250.0C5YF25_SORBI; Putative uncharacterized protein Sb06g027180
STRINGSb06g027180.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.13e-69myb domain protein 63